Lineage for d1uuta_ (1uut A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507732Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 507733Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (5 families) (S)
  5. 507757Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (1 protein)
  6. 507758Protein Replication protein Rep, nuclease domain [75493] (1 species)
  7. 507759Species Adeno-associated virus, aav-5 [TaxId:272636] [75494] (3 PDB entries)
  8. 507762Domain d1uuta_: 1uut A: [100022]

Details for d1uuta_

PDB Entry: 1uut (more details), 2 Å

PDB Description: the nuclease domain of adeno-associated virus rep complexed with the rbe' stemloop of the viral inverted terminal repeat

SCOP Domain Sequences for d1uuta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uuta_ d.89.1.3 (A:) Replication protein Rep, nuclease domain {Adeno-associated virus, aav-5}
matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir
rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf
qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle
erkrlvaqflaessq

SCOP Domain Coordinates for d1uuta_:

Click to download the PDB-style file with coordinates for d1uuta_.
(The format of our PDB-style files is described here.)

Timeline for d1uuta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uutb_