Lineage for d1uusa2 (1uus A:360-576)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768333Family b.2.5.5: STAT DNA-binding domain [81317] (4 proteins)
  6. 2768334Protein STAT homologue [101554] (1 species)
  7. 2768335Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101555] (2 PDB entries)
  8. 2768337Domain d1uusa2: 1uus A:360-576 [100020]
    Other proteins in same PDB: d1uusa1, d1uusa3

Details for d1uusa2

PDB Entry: 1uus (more details), 2.8 Å

PDB Description: structure of an activated dictyostelium stat in its dna-unbound form
PDB Compounds: (A:) stat protein

SCOPe Domain Sequences for d1uusa2:

Sequence, based on SEQRES records: (download)

>d1uusa2 b.2.5.5 (A:360-576) STAT homologue {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
pnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshptnknn
pttplemdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesdasnpf
vvitnecqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrplssyd
lkyiqthffgnrsiihqqdfdkfwvwfgksmqtlryq

Sequence, based on observed residues (ATOM records): (download)

>d1uusa2 b.2.5.5 (A:360-576) STAT homologue {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
pnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshpnpttp
lemdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesdasnpfvvit
necqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrplssydlkyi
qthffgnrsiihqqdfdkfwvwfgksmqtlryq

SCOPe Domain Coordinates for d1uusa2:

Click to download the PDB-style file with coordinates for d1uusa2.
(The format of our PDB-style files is described here.)

Timeline for d1uusa2: