![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
![]() | Superfamily a.47.1: STAT [47655] (2 families) ![]() |
![]() | Family a.47.1.1: STAT [47656] (3 proteins) |
![]() | Protein STAT homologue coiled coil domain [101220] (1 species) |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101221] (2 PDB entries) |
![]() | Domain d1uusa1: 1uus A:239-359 [100019] Other proteins in same PDB: d1uusa2, d1uusa3 three-helical fragment missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1uus (more details), 2.8 Å
SCOPe Domain Sequences for d1uusa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uusa1 a.47.1.1 (A:239-359) STAT homologue coiled coil domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} pnlsspqpildtiykllseqeqtlvqmiheqslllnrlpptldenslaplkslsqkqitl sgqmntemsaldatkkgmileptdlaklfalkqdlqiqfkqlsllhneiqsilnpqhsap k
Timeline for d1uusa1: