Lineage for d1uusa1 (1uus A:239-359)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. Superfamily a.47.1: STAT [47655] (2 families) (S)
  5. Family a.47.1.1: STAT [47656] (3 proteins)
  6. Protein STAT homologue coiled coil domain [101220] (1 species)
  7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101221] (2 PDB entries)
  8. Domain d1uusa1: 1uus A:239-359 [100019]
    Other proteins in same PDB: d1uusa2, d1uusa3
    three-helical fragment
    missing some secondary structures that made up less than one-third of the common domain

Details for d1uusa1

PDB Entry: 1uus (more details), 2.8 Å

PDB Description: structure of an activated dictyostelium stat in its dna-unbound form
PDB Compounds: (A:) stat protein

SCOPe Domain Sequences for d1uusa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uusa1 a.47.1.1 (A:239-359) STAT homologue coiled coil domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
pnlsspqpildtiykllseqeqtlvqmiheqslllnrlpptldenslaplkslsqkqitl
sgqmntemsaldatkkgmileptdlaklfalkqdlqiqfkqlsllhneiqsilnpqhsap
k

SCOPe Domain Coordinates for d1uusa1 are not available.

Timeline for d1uusa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uusa2, d1uusa3