![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.5: STAT DNA-binding domain [81317] (4 proteins) |
![]() | Protein STAT homologue [101554] (1 species) |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101555] (2 PDB entries) |
![]() | Domain d1uura2: 1uur A:360-576 [100017] Other proteins in same PDB: d1uura1, d1uura3 |
PDB Entry: 1uur (more details), 2.7 Å
SCOPe Domain Sequences for d1uura2:
Sequence, based on SEQRES records: (download)
>d1uura2 b.2.5.5 (A:360-576) STAT homologue {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} pnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshptnknn pttplemdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesdasnpf vvitnecqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrplssyd lkyiqthffgnrsiihqqdfdkfwvwfgksmqtlryq
>d1uura2 b.2.5.5 (A:360-576) STAT homologue {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} pnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshppttpl emdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesdasnpfvvitn ecqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrplssydlkyiq thffgnrsiihqqdfdkfwvwfgksmqtlryq
Timeline for d1uura2: