Lineage for d1uura1 (1uur A:242-359)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327609Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2327610Superfamily a.47.1: STAT [47655] (2 families) (S)
  5. 2327611Family a.47.1.1: STAT [47656] (3 proteins)
  6. 2327612Protein STAT homologue coiled coil domain [101220] (1 species)
  7. 2327613Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101221] (2 PDB entries)
  8. 2327614Domain d1uura1: 1uur A:242-359 [100016]
    Other proteins in same PDB: d1uura2, d1uura3
    three-helical fragment

Details for d1uura1

PDB Entry: 1uur (more details), 2.7 Å

PDB Description: structure of an activated dictyostelium stat in its dna-unbound form
PDB Compounds: (A:) stata protein

SCOPe Domain Sequences for d1uura1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uura1 a.47.1.1 (A:242-359) STAT homologue coiled coil domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
sspqpildtiykllseqeqtlvqmiheqslllnrlpptldenslaplkslsqkqitlsgq
mntemsaldatkkgmileptdlaklfalkqdlqiqfkqlsllhneiqsilnpqhsapk

SCOPe Domain Coordinates for d1uura1:

Click to download the PDB-style file with coordinates for d1uura1.
(The format of our PDB-style files is described here.)

Timeline for d1uura1: