![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
![]() | Superfamily a.47.1: STAT [47655] (2 families) ![]() |
![]() | Family a.47.1.1: STAT [47656] (3 proteins) |
![]() | Protein STAT homologue coiled coil domain [101220] (1 species) |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101221] (2 PDB entries) |
![]() | Domain d1uura1: 1uur A:242-359 [100016] Other proteins in same PDB: d1uura2, d1uura3 three-helical fragment missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1uur (more details), 2.7 Å
SCOPe Domain Sequences for d1uura1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uura1 a.47.1.1 (A:242-359) STAT homologue coiled coil domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} sspqpildtiykllseqeqtlvqmiheqslllnrlpptldenslaplkslsqkqitlsgq mntemsaldatkkgmileptdlaklfalkqdlqiqfkqlsllhneiqsilnpqhsapk
Timeline for d1uura1: