Lineage for d1uunb_ (1uun B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022603Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 3022604Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 3022747Family f.6.1.2: Porin MspA [103519] (1 protein)
    octameric fold contains barrel (n=16, S=16) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF09203
  6. 3022748Protein Porin MspA [103520] (1 species)
  7. 3022749Species Mycobacterium smegmatis [TaxId:1772] [103521] (1 PDB entry)
  8. 3022751Domain d1uunb_: 1uun B: [100013]

Details for d1uunb_

PDB Entry: 1uun (more details), 2.5 Å

PDB Description: main porin from mycobacterium smegmatis (mspa)
PDB Compounds: (B:) mspa

SCOPe Domain Sequences for d1uunb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uunb_ f.6.1.2 (B:) Porin MspA {Mycobacterium smegmatis [TaxId: 1772]}
gldnelslvdgqdrtltvqqwdtflngvfpldrnrltrewfhsgrakyivagpgadefeg
tlelgyqigfpwslgvginfsyttpniliddgditrppfglnsvitpnlfpgvsisadlg
ngpgiqevatfsvdvsgaeggvavsnahgtvtgaaggvllrpfarliastgdsvttygep
wnmn

SCOPe Domain Coordinates for d1uunb_:

Click to download the PDB-style file with coordinates for d1uunb_.
(The format of our PDB-style files is described here.)

Timeline for d1uunb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uuna_