Lineage for d1uuna_ (1uun A:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 619706Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 619707Superfamily f.6.1: Leukocidin-like [56959] (2 families) (S)
  5. 619736Family f.6.1.2: Porin MspA [103519] (1 protein)
    octameric fold contains barrel (n=16, S=16) formed by beta-ribbon arms, one from each subunit
  6. 619737Protein Porin MspA [103520] (1 species)
  7. 619738Species Mycobacterium smegmatis [TaxId:1772] [103521] (1 PDB entry)
  8. 619739Domain d1uuna_: 1uun A: [100012]

Details for d1uuna_

PDB Entry: 1uun (more details), 2.5 Å

PDB Description: main porin from mycobacterium smegmatis (mspa)

SCOP Domain Sequences for d1uuna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uuna_ f.6.1.2 (A:) Porin MspA {Mycobacterium smegmatis}
gldnelslvdgqdrtltvqqwdtflngvfpldrnrltrewfhsgrakyivagpgadefeg
tlelgyqigfpwslgvginfsyttpniliddgditrppfglnsvitpnlfpgvsisadlg
ngpgiqevatfsvdvsgaeggvavsnahgtvtgaaggvllrpfarliastgdsvttygep
wnmn

SCOP Domain Coordinates for d1uuna_:

Click to download the PDB-style file with coordinates for d1uuna_.
(The format of our PDB-style files is described here.)

Timeline for d1uuna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uunb_