Lineage for d1uumb_ (1uum B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080046Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2080109Species Norway rat (Rattus norvegicus) [TaxId:10116] [102039] (2 PDB entries)
  8. 2080111Domain d1uumb_: 1uum B: [100011]
    complexed with afi, bog, fmn, oro

Details for d1uumb_

PDB Entry: 1uum (more details), 2.3 Å

PDB Description: rat dihydroorotate dehydrogenase (dhod)in complex with atovaquone
PDB Compounds: (B:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d1uumb_:

Sequence, based on SEQRES records: (download)

>d1uumb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yaeylmpglqrlldpesahrlavrvtslgllpratfqdsdmlevkvlghkfrnpvgiaag
fdkngeavdglyklgfgfvevgsvtpqpqegnprprvfrlpedqavinrygfnshglsvv
ehrlrarqqkqaqltadglplginlgknktsedaaadyaegvrtlgpladylvvnvsspn
taglrslqgktelrhllskvlqerdalkgtrkpavlvkiapdltaqdkediasvarelgi
dglivtnttvsrpvglqgalrsetgglsgkplrdlstqtiremyaltqgripiigvggvs
sgqdalekiqagaslvqlytaliflgppvvvrvkreleallkergfttvtdaigadhrr

Sequence, based on observed residues (ATOM records): (download)

>d1uumb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yaeylmpglqrlldpesahrlavrvtslgllpratfqdsdmlevkvlghkfrnpvgiaag
fdkngeavdglyklgfgfvevgsvtpqpqegnprprvfrlpedqavinrygfnshglsvv
ehrlrarqqkqaqltadglplginlgknktsedaaadyaegvrtlgpladylvvnvssqg
ktelrhllskvlqerdalkgtrkpavlvkiapdltaqdkediasvarelgidglivtntt
vsrpvglqgalrsetgglsgkplrdlstqtiremyaltqgripiigvggvssgqdaleki
qagaslvqlytaliflgppvvvrvkreleallkergfttvtdaigadhrr

SCOPe Domain Coordinates for d1uumb_:

Click to download the PDB-style file with coordinates for d1uumb_.
(The format of our PDB-style files is described here.)

Timeline for d1uumb_: