![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.4: Link domain [56477] (3 proteins) |
![]() | Protein CD44, hyaluronan binding domain [103353] (1 species) contains extra N-terminal beta-strand and C-terminal beta-hairpin |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103354] (3 PDB entries) |
![]() | Domain d1uuhb_: 1uuh B: [100009] |
PDB Entry: 1uuh (more details), 2.2 Å
SCOPe Domain Sequences for d1uuhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uuhb_ d.169.1.4 (B:) CD44, hyaluronan binding domain {Human (Homo sapiens) [TaxId: 9606]} aqidlnitcrfagvfhvekngrysisrteaadlckafnstlptmaqmekalsigfetcry gfieghvviprihpnsicaanntgvyiltsntsqydtycfnasappeedctsvtdlpnaf dgpititivnrdgtryvqkgeyrtnpediy
Timeline for d1uuhb_: