Lineage for d1uuha_ (1uuh A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421327Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 421328Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 421648Family d.169.1.4: Link domain [56477] (2 proteins)
  6. 421649Protein CD44, hyaluronan binding domain [103353] (1 species)
    contains extra N-terminal beta-strand and C-terminal beta-hairpin
  7. 421650Species Human (Homo sapiens) [TaxId:9606] [103354] (2 PDB entries)
  8. 421651Domain d1uuha_: 1uuh A: [100008]

Details for d1uuha_

PDB Entry: 1uuh (more details), 2.2 Å

PDB Description: hyaluronan binding domain of human cd44

SCOP Domain Sequences for d1uuha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uuha_ d.169.1.4 (A:) CD44, hyaluronan binding domain {Human (Homo sapiens)}
aqidlnitcrfagvfhvekngrysisrteaadlckafnstlptmaqmekalsigfetcry
gfieghvviprihpnsicaanntgvyiltsntsqydtycfnasappeedctsvtdlpnaf
dgpititivnrdgtryvqkgeyrtnpediy

SCOP Domain Coordinates for d1uuha_:

Click to download the PDB-style file with coordinates for d1uuha_.
(The format of our PDB-style files is described here.)

Timeline for d1uuha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uuhb_