SCOP 1.71: Domain d1uufa2: 1uuf A:145-312

Lineage for d1uufa2 (1uuf A:145-312)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Hypothetical protein YahK [102128] (1 species)

7. Species Escherichia coli [TaxId:562] [102129] (1 PDB entry)

8. Domain d1uufa2: 1uuf A:145-312 [100007]
   Other proteins in same PDB: d1uufa1
   complexed with zn

Details for d1uufa2

PDB Entry: 1uuf, 1.76 Å

PDB Description: crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk

SCOP Domain Sequences for d1uufa2:

Sequence, based on SEQRES records:

>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli}
hpqeqlaavapllcagittysplrhwqagpgkkvgvvgigglghmgiklahamgahvvaf
ttseakreaakalgadevvnsrnademaahlksfdfilntvaaphnlddfttllkrdgtm
tlvgapatphkspevfnlimkrraiagsmiggipetqemldfcaehgi

Sequence, based on observed residues (ATOM records):

>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli}
hpqeqlaavapllcagittysplrhwqagpgkkvgvvgigglghmgiklahamgahvvaf
ttseakreaakalgadevvnsrnademaahlksfdfilntvaaphnlddfttllkrdgtm
tlvgapevfnlimkrraiagsmiggipetqemldfcaehgi

Timeline for d1uufa2:

• d1uufa2 first appeared in SCOP 1.67
  
• d1uufa2 appears in SCOP 1.69
  
• d1uufa2 appears in SCOP 1.73
  
• d1uufa2 appears in the current release, SCOPe 2.08