Lineage for d1uu9a_ (1uu9 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 611880Protein 3-phosphoinositide dependent protein kinase-1 Pdk1 [90036] (1 species)
    AGC group; PBK subfamily; serine/threonine kinase
  7. 611881Species Human (Homo sapiens) [TaxId:9606] [90037] (8 PDB entries)
  8. 611883Domain d1uu9a_: 1uu9 A: [100002]
    complexed with bi3, gol, so4

Details for d1uu9a_

PDB Entry: 1uu9 (more details), 1.95 Å

PDB Description: structure of human pdk1 kinase domain in complex with bim-3

SCOP Domain Sequences for d1uu9a_:

Sequence, based on SEQRES records: (download)

>d1uu9a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens)}
pqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrer
dvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivs
aleylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvsp
ellteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkard
lvekllvldatkrlgceemegygplkahpffesvtwenlhqqtppk

Sequence, based on observed residues (ATOM records): (download)

>d1uu9a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens)}
pqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrer
dvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivs
aleylhgkgiihrdlkpenillnedmhiqitdfgtakvlnsfvgtaqyvspellteksac
kssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvld
atkrlgceemegygplkahpffesvtwenlhqqtppk

SCOP Domain Coordinates for d1uu9a_:

Click to download the PDB-style file with coordinates for d1uu9a_.
(The format of our PDB-style files is described here.)

Timeline for d1uu9a_: