Lineage for d1uu8a_ (1uu8 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 611880Protein 3-phosphoinositide dependent protein kinase-1 Pdk1 [90036] (1 species)
    AGC group; PBK subfamily; serine/threonine kinase
  7. 611881Species Human (Homo sapiens) [TaxId:9606] [90037] (8 PDB entries)
  8. 611887Domain d1uu8a_: 1uu8 A: [100001]
    complexed with bi1, gol, so4

Details for d1uu8a_

PDB Entry: 1uu8 (more details), 2.5 Å

PDB Description: structure of human pdk1 kinase domain in complex with bim-1

SCOP Domain Sequences for d1uu8a_:

Sequence, based on SEQRES records: (download)

>d1uu8a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens)}
pqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrer
dvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivs
aleylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvsp
ellteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkard
lvekllvldatkrlgceemegygplkahpffesvtwenlhqqtppkl

Sequence, based on observed residues (ATOM records): (download)

>d1uu8a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens)}
pqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrer
dvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivs
aleylhgkgiihrdlkpenillnedmhiqitdfgtakvlsnsfvgtaqyvspellteksa
ckssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvl
datkrlgceemegygplkahpffesvtwenlhqqtppkl

SCOP Domain Coordinates for d1uu8a_:

Click to download the PDB-style file with coordinates for d1uu8a_.
(The format of our PDB-style files is described here.)

Timeline for d1uu8a_: