Lineage for d1uu7a_ (1uu7 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2195691Protein 3-phosphoinositide dependent protein kinase-1 Pdk1 [90036] (1 species)
    AGC group; PBK subfamily; serine/threonine kinase
  7. 2195692Species Human (Homo sapiens) [TaxId:9606] [90037] (25 PDB entries)
    Uniprot O15530 75-363
  8. 2195702Domain d1uu7a_: 1uu7 A: [100000]
    complexed with bi2, gol, so4

Details for d1uu7a_

PDB Entry: 1uu7 (more details), 1.9 Å

PDB Description: structure of human pdk1 kinase domain in complex with bim-2
PDB Compounds: (A:) 3-phosphoinositide dependent protein kinase-1

SCOPe Domain Sequences for d1uu7a_:

Sequence, based on SEQRES records: (download)

>d1uu7a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}
qprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerd
vmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsa
leylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspe
llteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardl
vekllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt

Sequence, based on observed residues (ATOM records): (download)

>d1uu7a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}
qprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerd
vmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsa
leylhgkgiihrdlkpenillnedmhiqitdfgtakvlspransfvgtaqyvspelltek
sackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekll
vldatkrlgceemegygplkahpffesvtwenlhqqtppklt

SCOPe Domain Coordinates for d1uu7a_:

Click to download the PDB-style file with coordinates for d1uu7a_.
(The format of our PDB-style files is described here.)

Timeline for d1uu7a_: