Lineage for d8ruca2 (8ruc A:9-147)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195894Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2195895Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2195896Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 2195990Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (11 PDB entries)
  8. 2195991Domain d8ruca2: 8ruc A:9-147 [39245]
    Other proteins in same PDB: d8ruca1, d8rucc1, d8ruce1, d8rucg1, d8ruci_, d8rucj_, d8ruck_, d8rucl_
    complexed with cap, mg

Details for d8ruca2

PDB Entry: 8ruc (more details), 1.6 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate
PDB Compounds: (A:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d8ruca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d8ruca2 d.58.9.1 (A:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOPe Domain Coordinates for d8ruca2:

Click to download the PDB-style file with coordinates for d8ruca2.
(The format of our PDB-style files is described here.)

Timeline for d8ruca2: