![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.1: Cytokine [50353] (3 families) ![]() |
![]() | Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins) |
![]() | Protein Interleukin-1beta [50363] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [50365] (2 PDB entries) |
![]() | Domain d8i1ba_: 8i1b A: [25550] |
PDB Entry: 8i1b (more details), 2.4 Å
SCOPe Domain Sequences for d8i1ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d8i1ba_ b.42.1.2 (A:) Interleukin-1beta {Mouse (Mus musculus) [TaxId: 10090]} qlhyrlrdeqqkslvlsdpyelkalhlngqninqqvifsmsfvqgepsndkipvalglkg knlylscvmkdgtptlqlesvdpkqypkkkmekrfvfnkievkskvefesaefpnwyist sqaehkpvflgnnsgqdiidftmesv
Timeline for d8i1ba_: