Lineage for d8i1ba_ (8i1b A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061773Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2061801Protein Interleukin-1beta [50363] (2 species)
  7. 2061830Species Mouse (Mus musculus) [TaxId:10090] [50365] (2 PDB entries)
  8. 2061831Domain d8i1ba_: 8i1b A: [25550]

Details for d8i1ba_

PDB Entry: 8i1b (more details), 2.4 Å

PDB Description: a comparison of the high resolution structures of human and murine interleukin-1b
PDB Compounds: (A:) interleukin-1 beta

SCOPe Domain Sequences for d8i1ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8i1ba_ b.42.1.2 (A:) Interleukin-1beta {Mouse (Mus musculus) [TaxId: 10090]}
qlhyrlrdeqqkslvlsdpyelkalhlngqninqqvifsmsfvqgepsndkipvalglkg
knlylscvmkdgtptlqlesvdpkqypkkkmekrfvfnkievkskvefesaefpnwyist
sqaehkpvflgnnsgqdiidftmesv

SCOPe Domain Coordinates for d8i1ba_:

Click to download the PDB-style file with coordinates for d8i1ba_.
(The format of our PDB-style files is described here.)

Timeline for d8i1ba_: