Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (12 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.3: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54434] (1 protein) |
Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species) |
Species Comamonas testosteroni and Pseudomonas testosteroni [54436] (6 PDB entries) |
Domain d8cho__: 8cho - [38108] complexed with p4c |
PDB Entry: 8cho (more details), 2.3 Å
SCOP Domain Sequences for d8cho__:
Sequence; same for both SEQRES and ATOM records: (download)
>d8cho__ d.17.4.3 (-) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni and Pseudomonas testosteroni} mntpehmtavvqryvaalnagdldgivalfaddatvedpvgseprsgtaairefyanslk lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn ihaga
Timeline for d8cho__: