Lineage for d8abpa_ (8abp A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1624507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1624508Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1624609Protein L-arabinose-binding protein [53826] (1 species)
  7. 1624610Species Escherichia coli [TaxId:562] [53827] (9 PDB entries)
  8. 1624611Domain d8abpa_: 8abp A: [35647]
    mutant

Details for d8abpa_

PDB Entry: 8abp (more details), 1.49 Å

PDB Description: sugar-binding and crystallographic studies of an arabinose-binding protein mutant (met108leu) which exhibits enhanced affinity and altered specificity
PDB Compounds: (A:) l-arabinose-binding protein

SCOPe Domain Sequences for d8abpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]}
nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmlaatkigerqgqel
ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
kaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
glggk

SCOPe Domain Coordinates for d8abpa_:

Click to download the PDB-style file with coordinates for d8abpa_.
(The format of our PDB-style files is described here.)

Timeline for d8abpa_: