Lineage for d7tima_ (7tim A:)
- Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins) Protein Triosephosphate isomerase [51353] (21 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51356] (8 PDB entries) 
Domain d7tima_: 7tim A: [28457]
complexed with pgh
Details for d7tima_
PDB Entry: 7tim (more details), 1.9 Å
PDB Description: structure of the triosephosphate isomerase-phosphoglycolohydroxamate complex: an analogue of the intermediate on the reaction pathway
PDB Compounds: (A:) triosephosphate isomeraseSCOPe Domain Sequences for d7tima_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7tima_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
diinsrn
SCOPe Domain Coordinates for d7tima_:
Click to download the PDB-style file with coordinates for d7tima_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7tima_:
- d7tima_ first appeared (with stable ids) in SCOP 1.55
- d7tima_ appears in SCOPe 2.01
- d7tima_ appears in SCOPe 2.03
- d7tima_ appears in the current release, SCOPe 2.08
View in 3D
