Lineage for d7taaa1 (7taa A:382-476)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domainFamily b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Fungal alpha-amylase [51028] (2 species) Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries) 
Domain d7taaa1: 7taa A:382-476 [27778]
Other proteins in same PDB: d7taaa2
complexed with abc, ca
Details for d7taaa1
PDB Entry: 7taa (more details), 1.98 Å
PDB Description: family 13 alpha amylase in complex with acarbose
PDB Compounds: (A:) taka amylaseSCOPe Domain Sequences for d7taaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7taaa1 b.71.1.1 (A:382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics
SCOPe Domain Coordinates for d7taaa1:
Click to download the PDB-style file with coordinates for d7taaa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7taaa1:
- d7taaa1 first appeared (with stable ids) in SCOP 1.55, called d7taa_1
- d7taaa1 appears in SCOPe 2.07
View in 3D
