Lineage for d7l6sa1 (7l6s A:119-364)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) 
Family d.122.1.0: automated matches [227160] (1 protein)
not a true familyProtein automated matches [226867] (22 species)
not a true protein
Species Balamuthia mandrillaris [TaxId:66527] [399532] (1 PDB entry) 
Domain d7l6sa1: 7l6s A:119-364 [399533]
Other proteins in same PDB: d7l6sa2
automated match to d1pvga2
complexed with anp, edo, mg
Details for d7l6sa1
PDB Entry: 7l6s (more details), 1.95 Å
PDB Description: crystal structure of the atpase and transducer domains of dna topoisomerase ii from balamuthia mandrillaris cdc:v039: baboon/san diego/1986
PDB Compounds: (A:) DNA topoisomerase IISCOPe Domain Sequences for d7l6sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7l6sa1 d.122.1.0 (A:119-364) automated matches {Balamuthia mandrillaris [TaxId: 66527]}
ktpeelyqkktpiehvllrpdtylgsvlrttepgmwvydpdsrrmverectyvpalykif
deilvnaadnkqrdpntstievnidadtntisvfndgrgipvhvhktegmylpemlfghl
ltssnyddseakvtggrngygakltniyskeftvetvdcerglrfqqtwrdnmsvreepl
itplspeekahgdytkitfrpdlsrldsmhslrdgdiigvmsrrafdvaacnegldvyln
geklps
SCOPe Domain Coordinates for d7l6sa1:
Click to download the PDB-style file with coordinates for d7l6sa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7l6sa1:
- d7l6sa1 first appeared in SCOPe 2.07
View in 3D
