| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) ![]() automatically mapped to Pfam PF01194 |
| Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
| Protein automated matches [190336] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [398822] (1 PDB entry) |
| Domain d7d59j_: 7d59 J: [398823] Other proteins in same PDB: d7d59f_, d7d59h_, d7d59k_, d7d59l_ automated match to d4c2mj_ complexed with sf4, zn |
PDB Entry: 7d59 (more details), 3.1 Å
SCOPe Domain Sequences for d7d59j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d59j_ a.4.11.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miipvrcftcgkivgnkweaylgllqaeytegdaldalglkryccrrmllahvdliekll
nyaplek
Timeline for d7d59j_:
View in 3DDomains from other chains: (mouse over for more information) d7d59f_, d7d59h_, d7d59k_, d7d59l_ |