Lineage for d7c5da_ (7c5d A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domainSuperfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) 
automatically mapped to Pfam PF08558Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (3 proteins) 
Protein automated matches [389799] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [389800] (1 PDB entry) 
Domain d7c5da_: 7c5d A: [389801]
automated match to d3bu8b_
protein/DNA complex; complexed with gol
Details for d7c5da_
PDB Entry: 7c5d (more details), 2.15 Å
PDB Description: crystal structure of trf2 trfh domain in complex with a mcph1 peptide
PDB Compounds: (A:) Telomeric repeat-binding factor 2SCOPe Domain Sequences for d7c5da_:
Sequence, based on SEQRES records: (download)
>d7c5da_ a.146.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrvmqc
lsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaaviici
knkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkmlrfle
shlddaepylltmakkal
Sequence, based on observed residues (ATOM records): (download)
>d7c5da_ a.146.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrvmqc
lsrieegenldcsfdmltplesainvlemikteftlteavvessrklvkeaaviiciknk
efekaskilkkhmskdttqklrndllniireknlahpviqnfsyetfqqkmlrfleshld
daepylltmakkal
SCOPe Domain Coordinates for d7c5da_:
Click to download the PDB-style file with coordinates for d7c5da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7c5da_:
- d7c5da_ first appeared in SCOPe 2.07
View in 3D
