Lineage for d7ahla_ (7ahl A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628131Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 2628132Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 2628133Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 2628134Protein Alpha-hemolysin [56961] (2 species)
  7. 2628135Species Staphylococcus aureus [TaxId:1280] [56962] (9 PDB entries)
  8. 2628136Domain d7ahla_: 7ahl A: [43812]

Details for d7ahla_

PDB Entry: 7ahl (more details), 1.89 Å

PDB Description: alpha-hemolysin from staphylococcus aureus
PDB Compounds: (A:) alpha-hemolysin

SCOPe Domain Sequences for d7ahla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ahla_ f.6.1.1 (A:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOPe Domain Coordinates for d7ahla_:

Click to download the PDB-style file with coordinates for d7ahla_.
(The format of our PDB-style files is described here.)

Timeline for d7ahla_: