Lineage for d6xppa_ (6xpp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2838112Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins)
    forms a swapped dimer
  6. 2838136Protein Isocitrate lyase [51642] (5 species)
    elaborated with additional subdomains
  7. 2838184Species Mycobacterium tuberculosis [TaxId:83332] [393401] (2 PDB entries)
  8. 2838185Domain d6xppa_: 6xpp A: [393436]
    automated match to d5dqla_
    complexed with itn, mg
    has additional subdomain(s) that are not in the common domain

Details for d6xppa_

PDB Entry: 6xpp (more details), 1.55 Å

PDB Description: crystal structure of itaconate modified mycobaterium tuberculosis isocitrate lyase
PDB Compounds: (A:) isocitrate lyase

SCOPe Domain Sequences for d6xppa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xppa_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 83332]}
svvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweqlh
dlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqvv
rrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagshw
edqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsdv
derdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfseav
kaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfdl
aygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltgs
teegqf

SCOPe Domain Coordinates for d6xppa_:

Click to download the PDB-style file with coordinates for d6xppa_.
(The format of our PDB-style files is described here.)

Timeline for d6xppa_: