Lineage for d6xe3b_ (6xe3 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) 
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) 
Protein Tryptophan synthase, beta-subunit [53688] (4 species) Species Salmonella typhimurium [TaxId:90371] [53689] (66 PDB entries) 
Domain d6xe3b_: 6xe3 B: [401098]
Other proteins in same PDB: d6xe3a_
automated match to d4zqcb_
complexed with 1d0, cl, cs, dms, edo, f9f; mutant
Details for d6xe3b_
PDB Entry: 6xe3 (more details), 1.55 Å
PDB Description: salmonella typhimurium tryptophan synthase beta-s377a mutant in complex with inhibitor f9 at the enzyme alpha-site, cesium ion at the metal coordination site and carbanion iii e(c3) at the enzyme beta- site.
PDB Compounds: (B:) tryptophan synthase beta chainSCOPe Domain Sequences for d6xe3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xe3b_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlagrgdkdiftvhdilkargei
SCOPe Domain Coordinates for d6xe3b_:
Click to download the PDB-style file with coordinates for d6xe3b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6xe3b_:
- d6xe3b_ first appeared in SCOPe 2.07
View in 3D
