Lineage for d6w61a_ (6w61 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.25: mRNA cap methylase [88785] (4 proteins) Protein automated matches [190302] (11 species)
not a true protein
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [420071] (20 PDB entries) 
Domain d6w61a_: 6w61 A: [412068]
Other proteins in same PDB: d6w61b_
automated match to d2xyqa_
complexed with cl, edo, sam, zn
Details for d6w61a_
PDB Entry: 6w61 (more details), 2 Å
PDB Description: crystal structure of the methyltransferase-stimulatory factor complex of nsp16 and nsp10 from sars cov-2.
PDB Compounds: (A:) 2'-O-methyltransferaseSCOPe Domain Sequences for d6w61a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w61a_ c.66.1.25 (A:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
mssqawqpgvampnlykmqrmllekcdlqnygdsatlpkgimmnvakytqlcqylntltl
avpynmrvihfgagsdkgvapgtavlrqwlptgtllvdsdlndfvsdadstligdcatvh
tankwdliisdmydpktknvtkendskegfftyicgfiqqklalggsvaikitehswnad
lyklmghfawwtafvtnvnassseafligcnylgkpreqidgyvmhanyifwrntnpiql
ssyslfdmskfplklrgtavmslkegqindmilsllskgrliirennrvvissdvlvnn
SCOPe Domain Coordinates for d6w61a_:
Click to download the PDB-style file with coordinates for d6w61a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6w61a_:
- d6w61a_ is new in SCOPe 2.08-stable
View in 3D
