Lineage for d6s2za_ (6s2z A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792578Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2792579Protein automated matches [190445] (12 species)
    not a true protein
  7. 2792590Species Brassica oleracea [TaxId:3715] [378394] (1 PDB entry)
  8. 2792591Domain d6s2za_: 6s2z A: [378395]
    automated match to d1r8na_
    complexed with chl

Details for d6s2za_

PDB Entry: 6s2z (more details), 2.5 Å

PDB Description: water-soluble chlorophyll protein (wscp) from brassica oleracea var. botrytis with chlorophyll-b
PDB Compounds: (A:) Water-soluble chlorophyll protein

SCOPe Domain Sequences for d6s2za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6s2za_ b.42.4.0 (A:) automated matches {Brassica oleracea [TaxId: 3715]}
reqvkdsngnpvkrgakyfiqpaksnggglvpaainilpfcplgitqtllpyqpglpvsf
gyepvivgtdyiytsttiniefrseiwpvcnelsklwavdvsssaakepaiiiggertap
nslfkieeatgahtyklttssgtvgtipgpwlgapqliatnddaktlfvkfvkvd

SCOPe Domain Coordinates for d6s2za_:

Click to download the PDB-style file with coordinates for d6s2za_.
(The format of our PDB-style files is described here.)

Timeline for d6s2za_: