Lineage for d6qfsa_ (6qfs A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767217Family b.2.2.1: Cellulose-binding domain family II [49385] (3 proteins)
    automatically mapped to Pfam PF00553
  6. 2767230Protein automated matches [378345] (1 species)
    not a true protein
  7. 2767231Species Cellulomonas fimi [TaxId:1708] [378346] (1 PDB entry)
  8. 2767232Domain d6qfsa_: 6qfs A: [378378]
    Other proteins in same PDB: d6qfsb2, d6qfsd2, d6qfsg2, d6qfsh2
    automated match to d1exha_
    complexed with 1ps, act, edo, ete, fmt, gol, peg

Details for d6qfsa_

PDB Entry: 6qfs (more details), 2.2 Å

PDB Description: chargeless variant of the cellulose-binding domain from cellulomonas fimi
PDB Compounds: (A:) Exoglucanase/xylanase

SCOPe Domain Sequences for d6qfsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qfsa_ b.2.2.1 (A:) automated matches {Cellulomonas fimi [TaxId: 1708]}
gcqvlwgvnqwntgftanvtvqntssapvqgwtltfsfpsgqqvtqawsstvtqsgsavt
vqnapwngsipaggtaqfgfngswtgtnaaptafslngtpctvg

SCOPe Domain Coordinates for d6qfsa_:

Click to download the PDB-style file with coordinates for d6qfsa_.
(The format of our PDB-style files is described here.)

Timeline for d6qfsa_: