Lineage for d6prcm_ (6prc M:)
- Root: SCOPe 2.07
Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) 
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
five transmembrane helices forming a sheet-like structureSuperfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) 
automatically mapped to Pfam PF00124Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
L and M are probably related to each other
Protein M (medium) subunit [81481] (4 species) 
Species Rhodopseudomonas viridis [TaxId:1079] [81478] (21 PDB entries) 
Domain d6prcm_: 6prc M: [43435]
Other proteins in same PDB: d6prcc_, d6prch1, d6prch2, d6prch3, d6prcl_
complexed with bcb, bpb, ceb, fe2, hem, lda, mq7, ns5, so4
Details for d6prcm_
PDB Entry: 6prc (more details), 2.3 Å
PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420314 (triazine) complex)
PDB Compounds: (M:) photosynthetic reaction centerSCOPe Domain Sequences for d6prcm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk
SCOPe Domain Coordinates for d6prcm_:
Click to download the PDB-style file with coordinates for d6prcm_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6prcm_:
- d6prcm_ first appeared (with stable ids) in SCOP 1.55, called d6prcm1
- d6prcm_ appears in SCOPe 2.06
- d6prcm_ appears in the current release, SCOPe 2.08
View in 3D
