Lineage for d6oaxa1 (6oax A:546-857)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871929Species Escherichia coli [TaxId:83333] [334882] (9 PDB entries)
  8. 2871942Domain d6oaxa1: 6oax A:546-857 [371150]
    automated match to d1qvra3
    complexed with adp, ags; mutant

Details for d6oaxa1

PDB Entry: 6oax (more details), 2.9 Å

PDB Description: structure of the hyperactive clpb mutant k476c, bound to casein, pre- state
PDB Compounds: (A:) Hyperactive disaggregase ClpB

SCOPe Domain Sequences for d6oaxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oaxa1 c.37.1.0 (A:546-857) automated matches {Escherichia coli [TaxId: 83333]}
ipvsrmmeserekllrmeqelhhrvigqneavdavsnairrsragladpnrpigsflflg
ptgvgktelckalanfmfdsdeamvridmsefmekhsvsrlvgappgyvgyeeggyltea
vrrrpysvilldevekahpdvfnillqvlddgrltdgqgrtvdfrntvvimtsnlgsdli
qerfgeldyahmkelvlgvvshnfrpefinridevvvfhplgeqhiasiaqiqlkrlykr
leergyeihisdealkllsengydpvygarplkraiqqqienplaqqilsgelvpgkvir
levnedrivavq

SCOPe Domain Coordinates for d6oaxa1:

Click to download the PDB-style file with coordinates for d6oaxa1.
(The format of our PDB-style files is described here.)

Timeline for d6oaxa1: