![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (5 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [225828] (15 PDB entries) |
![]() | Domain d6kvma1: 6kvm A:1-84 [378561] Other proteins in same PDB: d6kvma2, d6kvmb2 automated match to d1fnga2 complexed with gol |
PDB Entry: 6kvm (more details), 1.9 Å
SCOPe Domain Sequences for d6kvma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kvma1 d.19.1.0 (A:1-84) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} lkphvllqaefyqrsegpdkawaqfgfhfdadelfhveldaaqtvwrlpefgrfasfeaq galqnmavgkqnlevmisnsnrsq
Timeline for d6kvma1: