Lineage for d6kvma1 (6kvm A:1-84)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938653Species Chicken (Gallus gallus) [TaxId:9031] [225828] (15 PDB entries)
  8. 2938658Domain d6kvma1: 6kvm A:1-84 [378561]
    Other proteins in same PDB: d6kvma2, d6kvmb2
    automated match to d1fnga2
    complexed with gol

Details for d6kvma1

PDB Entry: 6kvm (more details), 1.9 Å

PDB Description: crystal structure of chicken mhc class ii for 1.9 angstrom
PDB Compounds: (A:) MHC class II alpha chain

SCOPe Domain Sequences for d6kvma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kvma1 d.19.1.0 (A:1-84) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lkphvllqaefyqrsegpdkawaqfgfhfdadelfhveldaaqtvwrlpefgrfasfeaq
galqnmavgkqnlevmisnsnrsq

SCOPe Domain Coordinates for d6kvma1:

Click to download the PDB-style file with coordinates for d6kvma1.
(The format of our PDB-style files is described here.)

Timeline for d6kvma1:

2938658
d6kvma1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6kvma2