Lineage for d6eixa_ (6eix A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2983389Species Human (Homo sapiens) [TaxId:9606] [188447] (844 PDB entries)
  8. 2984201Domain d6eixa_: 6eix A: [339462]
    automated match to d3h9ra_
    complexed with a3f, edo; mutant

Details for d6eixa_

PDB Entry: 6eix (more details), 2.3 Å

PDB Description: crystal structure of the kinase domain of the q207e mutant of acvr1 (alk2) in complex with a 2-aminopyridine inhibitor k02288
PDB Compounds: (A:) Activin receptor type-1

SCOPe Domain Sequences for d6eixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eixa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgsglpflvqrtvareitllecvgkgrygevwrgswqgenvavkifssrdekswfretel
yntvmlrhenilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivls
iasglahlhieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvg
nnprvgtkrymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppf
ydvvpndpsfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalri
kktltkidnsld

SCOPe Domain Coordinates for d6eixa_:

Click to download the PDB-style file with coordinates for d6eixa_.
(The format of our PDB-style files is described here.)

Timeline for d6eixa_: