Lineage for d6ehpa_ (6ehp A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. Protein automated matches [190414] (3 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries)
  8. Domain d6ehpa_: 6ehp A: [339755]
    automated match to d1veta_
    complexed with cl

Details for d6ehpa_

PDB Entry: 6ehp (more details), 2.3 Å

PDB Description: the crystal structure of the human lamtor complex
PDB Compounds: (A:) Ragulator complex protein LAMTOR3

SCOPe Domain Sequences for d6ehpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ehpa_ d.110.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqg
sklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqv
ve

SCOPe Domain Coordinates for d6ehpa_ are not available.

Timeline for d6ehpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ehpb_