Lineage for d6bqda_ (6bqd A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2708153Domain d6bqda_: 6bqd A: [365009]
    automated match to d4nqna_
    complexed with 69g

Details for d6bqda_

PDB Entry: 6bqd (more details), 2.14 Å

PDB Description: taf1-bd2 bromodomain in complex with (e)-3-(6-(but-2-en-1-yl)-7-oxo-6, 7-dihydro-1h-pyrrolo[2,3-c]pyridin-4-yl)-n,n-dimethylbenzamide
PDB Compounds: (A:) Transcription initiation factor TFIID subunit 1

SCOPe Domain Sequences for d6bqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bqda_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkniskh
kyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekdict
akeaaleea

SCOPe Domain Coordinates for d6bqda_:

Click to download the PDB-style file with coordinates for d6bqda_.
(The format of our PDB-style files is described here.)

Timeline for d6bqda_:

2708153
d6bqda_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d6bqdb_