Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256270] (3 PDB entries) |
Domain d6blba2: 6blb A:260-338 [341832] Other proteins in same PDB: d6blba1 automated match to d1in4a1 protein/DNA complex; complexed with adp, pge |
PDB Entry: 6blb (more details), 1.88 Å
SCOPe Domain Sequences for d6blba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6blba2 a.4.5.0 (A:260-338) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} rgfdhldrrllltmidkfdggpvgidnlaaalseerhtiedvlepyliqqgyimrtprgr vvtrhaylhfglnipkrlg
Timeline for d6blba2: