Lineage for d6axua_ (6axu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731887Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2731888Protein automated matches [196409] (46 species)
    not a true protein
  7. 2732074Species Streptomyces coelicolor [TaxId:100226] [279808] (22 PDB entries)
  8. 2732087Domain d6axua_: 6axu A: [340219]
    automated match to d3lg5a_
    complexed with btm, mg, pop

Details for d6axua_

PDB Entry: 6axu (more details), 1.82 Å

PDB Description: w203y epi-isozizaene synthase
PDB Compounds: (A:) Epi-isozizaene synthase

SCOPe Domain Sequences for d6axua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6axua_ a.128.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
avppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmag
yylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhe
dtlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrr
ltfahwiytdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiagdevh
nlgislithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgav
ranvgnmrnwfssvywfhhesgrymvdswddrstppyvnn

SCOPe Domain Coordinates for d6axua_:

Click to download the PDB-style file with coordinates for d6axua_.
(The format of our PDB-style files is described here.)

Timeline for d6axua_: