Lineage for d5y4za2 (5y4z A:482-617)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (158 species)
not a true protein
Species Zika virus (strain mr 766) [TaxId:64320] [319757] (10 PDB entries) 
Domain d5y4za2: 5y4z A:482-617 [338852]
Other proteins in same PDB: d5y4za1
automated match to d2bmfa1
complexed with anp, mn
Details for d5y4za2
PDB Entry: 5y4z (more details), 1.3 Å
PDB Description: crystal structure of the zika virus ns3 helicase complex with amppnp
PDB Compounds: (A:) NS3 helicaseSCOPe Domain Sequences for d5y4za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y4za2 c.37.1.0 (A:482-617) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
eghahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl
pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtkygekrvlkprwmdarvcs
dhaalksfkefaagkr
SCOPe Domain Coordinates for d5y4za2:
Click to download the PDB-style file with coordinates for d5y4za2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5y4za2:
- d5y4za2 first appeared in SCOPe 2.06
- d5y4za2 appears in SCOPe 2.07
View in 3D
