Lineage for d5xr2a1 (5xr2 A:7-292)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. Protein automated matches [190197] (23 species)
    not a true protein
  7. Species Staphylococcus aureus [TaxId:158878] [280201] (7 PDB entries)
  8. Domain d5xr2a1: 5xr2 A:7-292 [341067]
    Other proteins in same PDB: d5xr2a2, d5xr2c2, d5xr2g2
    automated match to d1izya_
    complexed with lac, zn

Details for d5xr2a1

PDB Entry: 5xr2 (more details), 2.6 Å

PDB Description: sav0551
PDB Compounds: (A:) Protein/nucleic acid deglycase HchA

SCOPe Domain Sequences for d5xr2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xr2a1 c.23.16.0 (A:7-292) automated matches {Staphylococcus aureus [TaxId: 158878]}
elskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryvl
lengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistynk
lkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrfi
vtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltkq
glkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnk

SCOPe Domain Coordinates for d5xr2a1 are not available.

Timeline for d5xr2a1:

Domains from same chain:
(mouse over for more information)
d5xr2a2
Domains from other chains:
(mouse over for more information)
d5xr2b_, d5xr2c1, d5xr2c2, d5xr2d_, d5xr2e_, d5xr2f_, d5xr2g1, d5xr2g2, d5xr2h_