Lineage for d5xe0a_ (5xe0 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623022Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2623336Protein automated matches [190260] (25 species)
    not a true protein
  7. 2623356Species Enterovirus d68 [TaxId:42789] [336371] (3 PDB entries)
  8. 2623359Domain d5xe0a_: 5xe0 A: [336372]
    automated match to d4wfxa_
    protein/RNA complex; complexed with gtp

Details for d5xe0a_

PDB Entry: 5xe0 (more details), 2.3 Å

PDB Description: crystal structure of ev-d68-3dpol in complex with gtp
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5xe0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xe0a_ e.8.1.4 (A:) automated matches {Enterovirus d68 [TaxId: 42789]}
geivsneksgvcinapaktklqpsvfhqvfegskepavlnskdprlktdfeeaifskytg
nkimlmdeymeeavdhyvgclepldisvdpiplesamygmdglealdlttsagfpyllqg
kkkrdifnrhtrdttemtkmlekygvdlpfvtfvkdelrskekvekgksrlieasslnds
vamrvafgnlyatfhsnpgtatgsavgcdpdifwskipilldgeifafdytgydaslspv
wfaclkkvliklgythqtsfidylchsvhlykdrkyivnggmpsgssgtsifntminnii
irtllirvykgidldqfkmiaygddviasyphkidpallaeagkhyglvmtpadkgtsfv
dtnwenvtflkryfraddqypflihpvmpmkeihesirwtkdprntqdhvrslcylawhn
geeaynefcrkirsvpvgraltlpaysslrrkwldsf

SCOPe Domain Coordinates for d5xe0a_:

Click to download the PDB-style file with coordinates for d5xe0a_.
(The format of our PDB-style files is described here.)

Timeline for d5xe0a_: