Lineage for d5wxba_ (5wxb A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501329Family c.66.1.25: mRNA cap methylase [88785] (3 proteins)
  6. 2501374Protein automated matches [190302] (8 species)
    not a true protein
  7. 2501398Species Zika virus (strain mr 766) [TaxId:64320] [322798] (8 PDB entries)
  8. 2501402Domain d5wxba_: 5wxb A: [334428]
    automated match to d2xbma_
    complexed with sah

Details for d5wxba_

PDB Entry: 5wxb (more details), 1.76 Å

PDB Description: crystal structure of zikv mtase in complex with sah
PDB Compounds: (A:) MRNA cap 0-1 NS5-type MT

SCOPe Domain Sequences for d5wxba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wxba_ c.66.1.25 (A:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
gtgetlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsakl
rwlvergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepvlvqsygwn
ivrlksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcik
vlcpytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllg
rmdgprrpvkyeedvnlgsgtrav

SCOPe Domain Coordinates for d5wxba_:

Click to download the PDB-style file with coordinates for d5wxba_.
(The format of our PDB-style files is described here.)

Timeline for d5wxba_: