Lineage for d5wtpa1 (5wtp A:335-454)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960608Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2960634Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2960635Protein automated matches [195455] (14 species)
    not a true protein
  7. 2960693Species Capnocytophaga gingivalis [TaxId:553178] [342874] (1 PDB entry)
  8. 2960694Domain d5wtpa1: 5wtp A:335-454 [342914]
    Other proteins in same PDB: d5wtpa2, d5wtpb2, d5wtpc2
    automated match to d4pwta_
    complexed with so4

Details for d5wtpa1

PDB Entry: 5wtp (more details), 2.15 Å

PDB Description: crystal structure of the c-terminal domain of outer membrane protein a (ompa) from capnocytophaga gingivalis
PDB Compounds: (A:) OmpA family protein

SCOPe Domain Sequences for d5wtpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wtpa1 d.79.7.0 (A:335-454) automated matches {Capnocytophaga gingivalis [TaxId: 553178]}
epdekeqkqlnqyaktilfdtgkatikfqsaevlnqiinvlkkypnsrfrieghtdstgk
kaknmilsqnradavkvyliqggidagrlesqgfgpekpiasnknkkgrelnrrveinli

SCOPe Domain Coordinates for d5wtpa1:

Click to download the PDB-style file with coordinates for d5wtpa1.
(The format of our PDB-style files is described here.)

Timeline for d5wtpa1:

2960694
d5wtpa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5wtpa2