SCOPe 2.08: Domain d5wtaa2: 5wta A:419-586

Lineage for d5wtaa2 (5wta A:419-586)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.3: Bacterial adhesins [49401] (7 families)
Family b.2.3.0: automated matches [191391] (1 protein)
not a true family
Protein automated matches [190503] (10 species)
not a true protein
Species Staphylococcus aureus [TaxId:158878] [336878] (2 PDB entries)
Domain d5wtaa2: 5wta A:419-586 [336880]
automated match to d1r17a2

Details for d5wtaa2

PDB Entry: 5wta (more details), 2.3 Å

PDB Description: crystal structure of staphylococcus aureus sdre apo form

PDB Compounds: (A:) Serine-aspartate repeat-containing protein E

SCOPe Domain Sequences for d5wtaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wtaa2 b.2.3.0 (A:419-586) automated matches {Staphylococcus aureus [TaxId: 158878]}
qdpmvhgdsniqsiftkldenkqtieqqiyvnplkktatntkvdiagsqvddygniklgn
gstiidqntemkvykvnpnqqlpqsnriydfsqyedvtsqfdnkksfsnnvatldfgdin
sayiikvvskytptsdgeldiaqgtsmrttdkygyynyagysnfivts

SCOPe Domain Coordinates for d5wtaa2:

Click to download the PDB-style file with coordinates for d5wtaa2.
(The format of our PDB-style files is described here.)

Timeline for d5wtaa2: