Lineage for d5w83b_ (5w83 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) 
Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
Protein Proteasome regulatory subunit Rpn11 [346088] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346338] (5 PDB entries) 
Domain d5w83b_: 5w83 B: [344421]
Other proteins in same PDB: d5w83a_
complexed with zn
Details for d5w83b_
PDB Entry: 5w83 (more details), 1.55 Å
PDB Description: rpn8/rpn11 dimer complex
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase RPN11SCOPe Domain Sequences for d5w83b_:
Sequence, based on SEQRES records: (download)
>d5w83b_ c.97.3.1 (B:) Proteasome regulatory subunit Rpn11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ketvyissiallkmlkhgragvpmevmglmlgefvddytvnvvdvfampqsgtgvsveav
ddvfqakmmdmlkqtgrdqmvvgwyhshpgfgcwlssvdvntqksfeqlnsravavvvdp
iqsvkgkvvidafrlidtgalinnleprqttsntgllnkaniqalihglnrhyyslnidy
hktaketkmlmnlhkeqwq
Sequence, based on observed residues (ATOM records): (download)
>d5w83b_ c.97.3.1 (B:) Proteasome regulatory subunit Rpn11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ketvyissiallkmlkhgragvpmevmglmlgefvddytvnvvdvfampqsavddvfqak
mmdmlkqtgrdqmvvgwyhshpgfgcwlssvdvntqksfeqlnsravavvvdpiqsvkgk
vvidafrlidhyyslnidyhktaketkmlmnlhkeqwq
SCOPe Domain Coordinates for d5w83b_:
Click to download the PDB-style file with coordinates for d5w83b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5w83b_:
- d5w83b_ first appeared in SCOPe 2.07
View in 3D
