Lineage for d5w72a_ (5w72 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395721Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 2395756Species Norway rat (Rattus norvegicus) [TaxId:10116] [50163] (14 PDB entries)
    Uniprot P31016 62-154
  8. 2395769Domain d5w72a_: 5w72 A: [342861]
    automated match to d3i4wa_
    complexed with azh

Details for d5w72a_

PDB Entry: 5w72 (more details)

PDB Description: impact of ir active probes on pdz3 and its ligand binding studied by nmr and x-ray crystallography
PDB Compounds: (A:) Disks large homolog 4

SCOPe Domain Sequences for d5w72a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w72a_ b.36.1.1 (A:) Synaptic protein PSD-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flgeedipreprrivihrgstglgfniiggedgegifisfxlaggpadlsgelrkgdqil
svngvdlrnasheqaaialknagqtvtiiaqykpeeysrfea

SCOPe Domain Coordinates for d5w72a_:

Click to download the PDB-style file with coordinates for d5w72a_.
(The format of our PDB-style files is described here.)

Timeline for d5w72a_: