Lineage for d5w6yb_ (5w6y B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732498Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2732499Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2732568Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. 2732569Protein automated matches [237402] (7 species)
    not a true protein
  7. 2732599Species Physcomitrella patens [TaxId:3218] [340155] (1 PDB entry)
  8. 2732601Domain d5w6yb_: 5w6y B: [340156]
    automated match to d4csma_
    complexed with epe, trp

Details for d5w6yb_

PDB Entry: 5w6y (more details), 2 Å

PDB Description: physcomitrella patens chorismate mutase
PDB Compounds: (B:) chorismate mutase

SCOPe Domain Sequences for d5w6yb_:

Sequence, based on SEQRES records: (download)

>d5w6yb_ a.130.1.0 (B:) automated matches {Physcomitrella patens [TaxId: 3218]}
epftlanireslirqedtiiyallqraqfsfnaptydensfsipgfkgslvefmlketet
lhakvrryqapdehpffpedlsqpilpslpksrvlhpaaekininksiwsmylqdllpkl
tvpdddgnygsasvcdvlclqalskrihygkfvaeakfiedparfeghikaqdgdailre
ltfknvednvkrrvankaraygqevnehgkvdnarykidpdlagalyedwvmpltkqvqv
ayllrrld

Sequence, based on observed residues (ATOM records): (download)

>d5w6yb_ a.130.1.0 (B:) automated matches {Physcomitrella patens [TaxId: 3218]}
epftlanireslirqedtiiyallqraqfsfnaptydensfsipgfkgslvefmlketet
lhakvrryqapdehpffpedlsqprvlhpaaekininksiwsmylqdllpkltvpdddgn
ygsasvcdvlclqalskrihygkfvaeakfiedparfeghikaqdgdailreltfknved
nvkrrvankaraygqerykidpdlagalyedwvmpltkqvqvayllrrld

SCOPe Domain Coordinates for d5w6yb_:

Click to download the PDB-style file with coordinates for d5w6yb_.
(The format of our PDB-style files is described here.)

Timeline for d5w6yb_: