Lineage for d5vlea_ (5vle A:)
- Root: SCOPe 2.08
Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
Protein automated matches [190161] (29 species)
not a true proteinSpecies Escherichia coli [TaxId:562] [187306] (111 PDB entries) 
Domain d5vlea_: 5vle A: [341418]
automated match to d4ua6a_
complexed with jsc, jsd, jse, k, po4, ru
Details for d5vlea_
PDB Entry: 5vle (more details), 0.85 Å
PDB Description: ultrahigh resolution x-ray crystal structure of ruthenocene conjugated penicilloate and penilloate products in complex with ctx-m-14 e166a beta-lactamase
PDB Compounds: (A:) Beta-lactamaseSCOPe Domain Sequences for d5vlea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vlea_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
etsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrtaptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl
SCOPe Domain Coordinates for d5vlea_:
Click to download the PDB-style file with coordinates for d5vlea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5vlea_:
- d5vlea_ first appeared in SCOPe 2.06
- d5vlea_ appears in SCOPe 2.07
View in 3D
