Lineage for d5vkia_ (5vki A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390760Species Human rotavirus a [TaxId:10941] [187643] (14 PDB entries)
  8. 2390774Domain d5vkia_: 5vki A: [341423]
    automated match to d2dwra_
    complexed with gal, gol, nag, nga, so4, thr

Details for d5vkia_

PDB Entry: 5vki (more details), 1.9 Å

PDB Description: crystal structure of p[19] rotavirus vp8* complexed with mucin core 2
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d5vkia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vkia_ b.29.1.0 (A:) automated matches {Human rotavirus a [TaxId: 10941]}
vldgpyqpvtfkppndywilinsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
ttdysttsnlneisvttyaefyiiprsqeskcteyintgl

SCOPe Domain Coordinates for d5vkia_:

Click to download the PDB-style file with coordinates for d5vkia_.
(The format of our PDB-style files is described here.)

Timeline for d5vkia_:

2390774
d5vkia_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d5vkib_