![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
![]() | Protein automated matches [190858] (25 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:171101] [350919] (3 PDB entries) |
![]() | Domain d5vfab2: 5vfa B:135-229 [350920] Other proteins in same PDB: d5vfaa1, d5vfaa3, d5vfab1, d5vfab3 automated match to d1kgsa1 mutant |
PDB Entry: 5vfa (more details), 1.45 Å
SCOPe Domain Sequences for d5vfab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vfab2 a.4.6.0 (B:135-229) automated matches {Streptococcus pneumoniae [TaxId: 171101]} rtyrnlridvehhtvyrgeemialtrreydllatlmgskkvltreqllesvwkyesatet nivdvyirylrskldvkgqksyiktvrgvgytmqe
Timeline for d5vfab2: